PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g004488m
Common NameCISIN_1g004488mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 750aa    MW: 84512.2 Da    PI: 5.3473
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g004488mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS396.82.3e-1213757461374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL+ cA+av+++d ++a +lL+++++++s++gd mqR+a +f+ +L+arla+s++++y al +++ts    +++l+a++lf  ++P+ k
  orange1.1g004488m 375 LRTLLTLCAQAVAANDRRNAYELLKQIRQHSSSTGDGMQRMAECFADGLEARLAGSGTQIYTALISKHTS---AADVLKAYHLFLAACPFRK 463
                        5789************************************************************999998...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +s++  N++I++ +e+++r+HiiDf+i++G+QWp+L+q L+sRp+g+p+lRiTg++ p++g   +e++eetg+rLak+Ae+++vpfefn+ +
  orange1.1g004488m 464 LSNFFSNKTIMNLAEKATRLHIIDFGIMYGFQWPCLIQRLSSRPGGAPKLRITGIDLPQPGfkPAERVEETGRRLAKYAETFKVPFEFNA-I 554
                        ************************************************************999***************************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a++++++++e+L++++gE+l+Vn+ ++  +llde+v ++ +r+ vL+l+++++P+v+v+   +  h+++ F +rf eal +ys+lfd+le++
  orange1.1g004488m 555 AQKWDTIQIEDLNIDSGEVLVVNCLYRFRNLLDETVVVDCPRNIVLNLIRKMNPDVFVLGIVNGAHSAPFFITRFREALFFYSTLFDMLETN 646
                        ******************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +pre  er+ +Ere++gre++nv+acegaer+er et+++W+ r ++aGF+++pl+e+++k ak  + + + + + ++e+s++l++gWk+r 
  orange1.1g004488m 647 VPREIPERMLIEREIFGREAMNVIACEGAERIERPETYKQWQVRNMRAGFTQLPLNEEIMKMAKERVDTNYHKDFVIDEDSQWLLQGWKGRI 738
                        ***********************************************************************888****************** PP

               GRAS 367 LvsvSaWr 374
                        ++++S W+
  orange1.1g004488m 739 VYALSTWK 746
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.138349726IPR005202Transcription factor GRAS
PfamPF035147.8E-119375746IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MVMDQRLSGF YGSVNQYKLN DETFSVLSDQ NLVIGFKTND TLVSQSYLDI QALPPNPVAD  60
SPNSSSVVTQ ERDSSEDYDF SDVVLKYINE MLMEEDMEEK TCMFQESSAA LQAAEKSLYE  120
LLGEKYPPQP SYVNKKFVDH DHESPDGTHD SSNSYCNTST ISAESDNLVD HGWNSDLSEC  180
KFSNFSSQST PQSSYGSSSS NSNVVDGFID SPVSSLKIPE IFRDSESALQ FKRGFEEASK  240
FLPNGNALFV DLKNNVSVVK ELKEEPKSVL VRMGKKPENE NSPEGSRGKK NPHPEEVSLE  300
RGRSNKQSAV STESTVSEEM FDMILLNCGQ SESVLREALQ NETSKNVRQN KQSRGSKGGK  360
ARGRKQGGNR DVVDLRTLLT LCAQAVAAND RRNAYELLKQ IRQHSSSTGD GMQRMAECFA  420
DGLEARLAGS GTQIYTALIS KHTSAADVLK AYHLFLAACP FRKLSNFFSN KTIMNLAEKA  480
TRLHIIDFGI MYGFQWPCLI QRLSSRPGGA PKLRITGIDL PQPGFKPAER VEETGRRLAK  540
YAETFKVPFE FNAIAQKWDT IQIEDLNIDS GEVLVVNCLY RFRNLLDETV VVDCPRNIVL  600
NLIRKMNPDV FVLGIVNGAH SAPFFITRFR EALFFYSTLF DMLETNVPRE IPERMLIERE  660
IFGREAMNVI ACEGAERIER PETYKQWQVR NMRAGFTQLP LNEEIMKMAK ERVDTNYHKD  720
FVIDEDSQWL LQGWKGRIVY ALSTWKPSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-473757465375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435553.10.0hypothetical protein CICLE_v10030787mg
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A067G0Q20.0A0A067G0Q2_CITSI; Uncharacterized protein
STRINGPOPTR_0008s05750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14